PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A03G1418
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 278aa    MW: 31677.2 Da    PI: 5.9814
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A03G1418genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.32.3e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd +l  +v+++G  +W+  ++  g+ R++k+c++rw +yl
      Gh_A03G1418 14 KGTWTPEEDRKLMAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNYL 61
                     799*****************99************************97 PP

2Myb_DNA-binding521.6e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ ++eE+e +++++  lG++ W++Ia+ ++ gRt++++k++w++ 
      Gh_A03G1418  67 RGSYSKEEEETIIRLHDSLGNR-WSAIAAQLP-GRTDNEVKNHWHTT 111
                      7999******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-23564IPR009057Homeodomain-like
PROSITE profilePS5129415.994961IPR017930Myb domain
SuperFamilySSF466896.79E-2911108IPR009057Homeodomain-like
SMARTSM007171.2E-81363IPR001005SANT/Myb domain
PfamPF002491.8E-131461IPR001005SANT/Myb domain
CDDcd001671.42E-81661No hitNo description
PROSITE profilePS5129424.57862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-2565116IPR009057Homeodomain-like
SMARTSM007177.4E-1666114IPR001005SANT/Myb domain
PfamPF002494.3E-1567111IPR001005SANT/Myb domain
CDDcd001677.31E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MVRTPCCDKT GLRKGTWTPE EDRKLMAYVT RYGCWNWRQL PKFAGLARCG KSCRLRWMNY  60
LRPNIKRGSY SKEEEETIIR LHDSLGNRWS AIAAQLPGRT DNEVKNHWHT TLKKRFKHKP  120
SAAAKDGKDN SSQDPKLRRG TSREKEETKL NDVDHLLISS PNPPLILESS LSSQQPASSD  180
QNSSITTDNT VVSSKLDSGS DDNSTTTNTN TDIHTDTLLE AYEAESSNFW TEPFLSDINY  240
MWSDVSSVVP YEADQFPLLD GEILYPFDFY DQVQGLDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29121165108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012479764.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLA0A0D2RIS20.0A0A0D2RIS2_G
STRINGPOPTR_0013s14560.11e-97(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.12e-59myb domain protein 15